Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.9: RalF, C-terminal domain [118104] (1 family) contains a single copy of this fold decorated with additional structures |
Family d.129.9.1: RalF, C-terminal domain [118105] (1 protein) |
Protein RalF, C-terminal domain [118106] (1 species) |
Species Legionella pneumophila [TaxId:446] [118107] (1 PDB entry) Uniprot Q8RT31 2-353 |
Domain d1xszb2: 1xsz B:198-354 [116008] Other proteins in same PDB: d1xsza1, d1xszb1 |
PDB Entry: 1xsz (more details), 1.41 Å
SCOPe Domain Sequences for d1xszb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xszb2 d.129.9.1 (B:198-354) RalF, C-terminal domain {Legionella pneumophila [TaxId: 446]} ktspgyeltsttlnkdstfkkldsflhstdvnintvfpgigdnvkttvdqpkswlsfftg ykgtitltdnktsaqatiqvytpnifskwlfgeqprviiqpgqtkesidlaakaaadfss pvknfkatydyevgdlikaydnqkklitiernlalka
Timeline for d1xszb2: