SCOP 1.73: Domain d1xszb2: 1xsz B:198-354

Lineage for d1xszb2 (1xsz B:198-354)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.129: TBP-like [55944] (10 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.9: RalF, C-terminal domain [118104] (1 family)
   contains a single copy of this fold decorated with additional structures

5. Family d.129.9.1: RalF, C-terminal domain [118105] (1 protein)

6. Protein RalF, C-terminal domain [118106] (1 species)

7. Species Legionella pneumophila [TaxId:446] [118107] (1 PDB entry)

8. Domain d1xszb2: 1xsz B:198-354 [116008]
   Other proteins in same PDB: d1xsza1, d1xszb1

Details for d1xszb2

PDB Entry: 1xsz, 1.41 Å

PDB Description: The structure of RalF

PDB Compounds: (B:) guanine nucleotide exchange protein

SCOP Domain Sequences for d1xszb2:

Sequence; same for both SEQRES and ATOM records:

>d1xszb2 d.129.9.1 (B:198-354) RalF, C-terminal domain {Legionella pneumophila [TaxId: 446]}
ktspgyeltsttlnkdstfkkldsflhstdvnintvfpgigdnvkttvdqpkswlsfftg
ykgtitltdnktsaqatiqvytpnifskwlfgeqprviiqpgqtkesidlaakaaadfss
pvknfkatydyevgdlikaydnqkklitiernlalka

Timeline for d1xszb2:

• d1xszb2 first appeared in SCOP 1.71
  
• d1xszb2 appears in SCOP 1.75
  
• d1xszb2 appears in the current release, SCOPe 2.08