Lineage for d1xszb2 (1xsz B:198-354)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610723Fold d.129: TBP-like [55944] (9 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 611025Superfamily d.129.9: RalF, C-terminal domain [118104] (1 family) (S)
    contains a single copy of this fold decorated with additional structures
  5. 611026Family d.129.9.1: RalF, C-terminal domain [118105] (1 protein)
  6. 611027Protein RalF, C-terminal domain [118106] (1 species)
  7. 611028Species Legionella pneumophila [TaxId:446] [118107] (1 PDB entry)
  8. 611030Domain d1xszb2: 1xsz B:198-354 [116008]
    Other proteins in same PDB: d1xsza1, d1xszb1

Details for d1xszb2

PDB Entry: 1xsz (more details), 1.41 Å

PDB Description: The structure of RalF

SCOP Domain Sequences for d1xszb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xszb2 d.129.9.1 (B:198-354) RalF, C-terminal domain {Legionella pneumophila}
ktspgyeltsttlnkdstfkkldsflhstdvnintvfpgigdnvkttvdqpkswlsfftg
ykgtitltdnktsaqatiqvytpnifskwlfgeqprviiqpgqtkesidlaakaaadfss
pvknfkatydyevgdlikaydnqkklitiernlalka

SCOP Domain Coordinates for d1xszb2:

Click to download the PDB-style file with coordinates for d1xszb2.
(The format of our PDB-style files is described here.)

Timeline for d1xszb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xszb1