Lineage for d1xszb1 (1xsz B:1-197)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 542684Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 542897Superfamily a.118.3: Sec7 domain [48425] (1 family) (S)
  5. 542898Family a.118.3.1: Sec7 domain [48426] (5 proteins)
    Pfam 01369
  6. 542917Protein RalF, N-terminal domain [117005] (1 species)
  7. 542918Species Legionella pneumophila [TaxId:446] [117006] (2 PDB entries)
  8. 542920Domain d1xszb1: 1xsz B:1-197 [116007]
    Other proteins in same PDB: d1xsza2, d1xszb2

Details for d1xszb1

PDB Entry: 1xsz (more details), 1.41 Å

PDB Description: The structure of RalF

SCOP Domain Sequences for d1xszb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xszb1 a.118.3.1 (B:1-197) RalF, N-terminal domain {Legionella pneumophila}
shpeiekaqreiieafnakpknginkikeiceqykispneeiaeffhqqrknldleavgd
ylsspeaenqqvlkaftsqmnfngqsfveglrtflktfklpgeaqkidrlvqsfsgayfq
qnpdvvsnadaayllafqtimlntdlhnpsipeknkmtvdglkrnlrggnnggdfdakfl
eelyseikakpfelnfv

SCOP Domain Coordinates for d1xszb1:

Click to download the PDB-style file with coordinates for d1xszb1.
(The format of our PDB-style files is described here.)

Timeline for d1xszb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xszb2