Lineage for d1xsza2 (1xsz A:198-354)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1218105Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1218674Superfamily d.129.9: RalF, C-terminal domain [118104] (1 family) (S)
    contains a single copy of this fold decorated with additional structures
  5. 1218675Family d.129.9.1: RalF, C-terminal domain [118105] (1 protein)
  6. 1218676Protein RalF, C-terminal domain [118106] (1 species)
  7. 1218677Species Legionella pneumophila [TaxId:446] [118107] (1 PDB entry)
    Uniprot Q8RT31 2-353
  8. 1218678Domain d1xsza2: 1xsz A:198-354 [116006]
    Other proteins in same PDB: d1xsza1, d1xszb1

Details for d1xsza2

PDB Entry: 1xsz (more details), 1.41 Å

PDB Description: The structure of RalF
PDB Compounds: (A:) guanine nucleotide exchange protein

SCOPe Domain Sequences for d1xsza2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsza2 d.129.9.1 (A:198-354) RalF, C-terminal domain {Legionella pneumophila [TaxId: 446]}
ktspgyeltsttlnkdstfkkldsflhstdvnintvfpgigdnvkttvdqpkswlsfftg
ykgtitltdnktsaqatiqvytpnifskwlfgeqprviiqpgqtkesidlaakaaadfss
pvknfkatydyevgdlikaydnqkklitiernlalka

SCOPe Domain Coordinates for d1xsza2:

Click to download the PDB-style file with coordinates for d1xsza2.
(The format of our PDB-style files is described here.)

Timeline for d1xsza2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xsza1