Lineage for d1xsza1 (1xsz A:1-197)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 922228Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 922229Family a.118.3.1: Sec7 domain [48426] (5 proteins)
    Pfam PF01369
  6. 922253Protein RalF, N-terminal domain [117005] (1 species)
  7. 922254Species Legionella pneumophila [TaxId:446] [117006] (2 PDB entries)
    Uniprot Q8RT31 2-353
  8. 922255Domain d1xsza1: 1xsz A:1-197 [116005]
    Other proteins in same PDB: d1xsza2, d1xszb2

Details for d1xsza1

PDB Entry: 1xsz (more details), 1.41 Å

PDB Description: The structure of RalF
PDB Compounds: (A:) guanine nucleotide exchange protein

SCOPe Domain Sequences for d1xsza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsza1 a.118.3.1 (A:1-197) RalF, N-terminal domain {Legionella pneumophila [TaxId: 446]}
shpeiekaqreiieafnakpknginkikeiceqykispneeiaeffhqqrknldleavgd
ylsspeaenqqvlkaftsqmnfngqsfveglrtflktfklpgeaqkidrlvqsfsgayfq
qnpdvvsnadaayllafqtimlntdlhnpsipeknkmtvdglkrnlrggnnggdfdakfl
eelyseikakpfelnfv

SCOPe Domain Coordinates for d1xsza1:

Click to download the PDB-style file with coordinates for d1xsza1.
(The format of our PDB-style files is described here.)

Timeline for d1xsza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xsza2