SCOPe 2.07: Domain d1xsva_: 1xsv A:

Lineage for d1xsva_ (1xsv A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families)

5. Family a.4.13.3: YlxM/p13-like [109706] (2 proteins)
   Pfam PF04297; UPF0122
   structural and detectable sequence similarity to Sigma4 domain; contains extra C-terminal all-alpha oligomerization subdomain; forms different, helix-swapped dimers

6. Protein Hypothetical protein SAV1236 [116818] (1 species)

7. Species Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId:1280] [116819] (1 PDB entry)
   Uniprot P67248

8. Domain d1xsva_: 1xsv A: [116003]

Details for d1xsva_

PDB Entry: 1xsv, 1.7 Å

PDB Description: X-ray crystal structure of conserved hypothetical UPF0122 protein SAV1236 from Staphylococcus aureus subsp. aureus Mu50

PDB Compounds: (A:) Hypothetical UPF0122 protein SAV1236

SCOPe Domain Sequences for d1xsva_:

Sequence; same for both SEQRES and ATOM records:

>d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]}
dlvktlrmnylfdfyqslltnkqrnylelfyledyslseiadtfnvsrqavydnirrtgd
lvedyekklelyqkfeqrreiydemkqhlsnpeqiqryiqqledle

Timeline for d1xsva_:

• d1xsva_ first appeared in SCOP 1.71
  
• d1xsva_ appears in SCOPe 2.06
  
• d1xsva_ appears in the current release, SCOPe 2.08