Lineage for d1xsva_ (1xsv A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984585Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 1984674Family a.4.13.3: YlxM/p13-like [109706] (2 protein domains)
    Pfam PF04297; UPF0122
    structural and detectable sequence similarity to Sigma4 domain; contains extra C-terminal all-alpha oligomerization subdomain; forms different, helix-swapped dimers
  6. 1984675Protein Hypothetical protein SAV1236 [116818] (1 species)
  7. 1984676Species Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId:1280] [116819] (1 PDB entry)
    Uniprot P67248
  8. 1984677Domain d1xsva_: 1xsv A: [116003]

Details for d1xsva_

PDB Entry: 1xsv (more details), 1.7 Å

PDB Description: X-ray crystal structure of conserved hypothetical UPF0122 protein SAV1236 from Staphylococcus aureus subsp. aureus Mu50
PDB Compounds: (A:) Hypothetical UPF0122 protein SAV1236

SCOPe Domain Sequences for d1xsva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsva_ a.4.13.3 (A:) Hypothetical protein SAV1236 {Staphylococcus aureus, strain Mu50 / ATCC 700699 [TaxId: 1280]}
dlvktlrmnylfdfyqslltnkqrnylelfyledyslseiadtfnvsrqavydnirrtgd
lvedyekklelyqkfeqrreiydemkqhlsnpeqiqryiqqledle

SCOPe Domain Coordinates for d1xsva_:

Click to download the PDB-style file with coordinates for d1xsva_.
(The format of our PDB-style files is described here.)

Timeline for d1xsva_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xsvb_