Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein) Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold |
Protein Ureidoglycolate hydrolase AllA [117313] (4 species) |
Species Shigella flexneri [TaxId:623] [117314] (2 PDB entries) Uniprot P77731 ! Uniprot P63487 |
Domain d1xsqb1: 1xsq B:1-160 [116000] Other proteins in same PDB: d1xsqb2 |
PDB Entry: 1xsq (more details), 1.6 Å
SCOPe Domain Sequences for d1xsqb1:
Sequence, based on SEQRES records: (download)
>d1xsqb1 b.82.1.14 (B:1-160) Ureidoglycolate hydrolase AllA {Shigella flexneri [TaxId: 623]} mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdctlisinraq panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa
>d1xsqb1 b.82.1.14 (B:1-160) Ureidoglycolate hydrolase AllA {Shigella flexneri [TaxId: 623]} mklqvlplsqeafsaygdvietqqrdffhiveryhdlalveileqdctlisinraqpanl pltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhrnvwh hplfawqrvtdfltidrgdncdvesipeqelcfa
Timeline for d1xsqb1: