SCOPe 2.06: Domain d1xsqb1: 1xsq B:1-160

Lineage for d1xsqb1 (1xsq B:1-160)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein)
   Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold

6. Protein Ureidoglycolate hydrolase AllA [117313] (4 species)

7. Species Shigella flexneri [TaxId:623] [117314] (2 PDB entries)
   Uniprot P77731 ! Uniprot P63487

8. Domain d1xsqb1: 1xsq B:1-160 [116000]
   Other proteins in same PDB: d1xsqb2

Details for d1xsqb1

PDB Entry: 1xsq, 1.6 Å

PDB Description: Crystal structure of ureidoglycolate hydrolase from E.coli. Northeast Structural Genomics Consortium target ET81.

PDB Compounds: (B:) Ureidoglycolate hydrolase

SCOPe Domain Sequences for d1xsqb1:

Sequence, based on SEQRES records:

>d1xsqb1 b.82.1.14 (B:1-160) Ureidoglycolate hydrolase AllA {Shigella flexneri [TaxId: 623]}
mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdctlisinraq
panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa

Sequence, based on observed residues (ATOM records):

>d1xsqb1 b.82.1.14 (B:1-160) Ureidoglycolate hydrolase AllA {Shigella flexneri [TaxId: 623]}
mklqvlplsqeafsaygdvietqqrdffhiveryhdlalveileqdctlisinraqpanl
pltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhrnvwh
hplfawqrvtdfltidrgdncdvesipeqelcfa

Timeline for d1xsqb1:

• d1xsqb1 first appeared in SCOP 1.71, called d1xsqb_
  
• d1xsqb1 was called d1xsqb_ in SCOPe 2.05
  
• d1xsqb1 appears in SCOPe 2.07
  
• d1xsqb1 appears in the current release, SCOPe 2.08