Class b: All beta proteins [48724] (165 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (20 families) |
Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein) Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold |
Protein Ureidoglycolate hydrolase AllA [117313] (3 species) |
Species Shigella flexneri [TaxId:623] [117314] (2 PDB entries) |
Domain d1xsqa_: 1xsq A: [115999] |
PDB Entry: 1xsq (more details), 1.6 Å
SCOP Domain Sequences for d1xsqa_:
Sequence, based on SEQRES records: (download)
>d1xsqa_ b.82.1.14 (A:) Ureidoglycolate hydrolase AllA {Shigella flexneri [TaxId: 623]} mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdctlisinraq panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa
>d1xsqa_ b.82.1.14 (A:) Ureidoglycolate hydrolase AllA {Shigella flexneri [TaxId: 623]} mklqvlplsqeafsaygdvietqqrdffhiveryhdlalveileqdctlisinraqpanl pltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhrnvwh hplfawqrvtdfltidrgdncdvesipeqelcfa
Timeline for d1xsqa_: