Lineage for d1xsqa_ (1xsq A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. Family b.82.1.14: Ureidoglycolate hydrolase AllA [117312] (1 protein)
    Pfam PF04115; beta-hairpin-swapped dimeric protein of the germin-like fold
  6. Protein Ureidoglycolate hydrolase AllA [117313] (4 species)
  7. Species Shigella flexneri [TaxId:623] [117314] (2 PDB entries)
    Uniprot P77731 ! Uniprot P63487
  8. Domain d1xsqa_: 1xsq A: [115999]
    Other proteins in same PDB: d1xsqb2

Details for d1xsqa_

PDB Entry: 1xsq (more details), 1.6 Å

PDB Description: Crystal structure of ureidoglycolate hydrolase from E.coli. Northeast Structural Genomics Consortium target ET81.
PDB Compounds: (A:) Ureidoglycolate hydrolase

SCOPe Domain Sequences for d1xsqa_:

Sequence, based on SEQRES records: (download)

>d1xsqa_ b.82.1.14 (A:) Ureidoglycolate hydrolase AllA {Shigella flexneri [TaxId: 623]}
mklqvlplsqeafsaygdvietqqrdffhinnglveryhdlalveileqdctlisinraq
panlpltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhr
nvwhhplfawqrvtdfltidrggsdncdvesipeqelcfa

Sequence, based on observed residues (ATOM records): (download)

>d1xsqa_ b.82.1.14 (A:) Ureidoglycolate hydrolase AllA {Shigella flexneri [TaxId: 623]}
mklqvlplsqeafsaygdvietqqrdffhiveryhdlalveileqdctlisinraqpanl
pltihelerhplgtqafipmkgevfvvvvalgddkpdlstlrafitngeqgvnyhrnvwh
hplfawqrvtdfltidrgdncdvesipeqelcfa

SCOPe Domain Coordinates for d1xsqa_ are not available.

Timeline for d1xsqa_:

Domains from other chains:
(mouse over for more information)
d1xsqb1, d1xsqb2