Lineage for d1xske1 (1xsk E:666-772)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433829Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 2433830Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) (S)
  5. 2433831Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (3 proteins)
  6. 2433845Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)
  7. 2433846Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)
    Uniprot P31434
  8. 2433869Domain d1xske1: 1xsk E:666-772 [115991]
    Other proteins in same PDB: d1xska2, d1xska3, d1xska4, d1xska5, d1xskb2, d1xskb3, d1xskb4, d1xskb5, d1xskc2, d1xskc3, d1xskc4, d1xskc5, d1xskd2, d1xskd3, d1xskd4, d1xskd5, d1xske2, d1xske3, d1xske4, d1xske5, d1xskf2, d1xskf3, d1xskf4, d1xskf5
    complexed with mpo, so4, xyf

Details for d1xske1

PDB Entry: 1xsk (more details), 2.2 Å

PDB Description: structure of a family 31 alpha glycosidase glycosyl-enzyme intermediate
PDB Compounds: (E:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xske1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xske1 b.150.1.1 (E:666-772) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl

SCOPe Domain Coordinates for d1xske1:

Click to download the PDB-style file with coordinates for d1xske1.
(The format of our PDB-style files is described here.)

Timeline for d1xske1: