Lineage for d1xskc2 (1xsk C:1-247)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 664384Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 664501Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 664821Family b.30.5.11: YicI N-terminal domain-like [117139] (2 proteins)
  6. 664825Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species)
  7. 664826Species Escherichia coli [TaxId:562] [117141] (5 PDB entries)
  8. 664841Domain d1xskc2: 1xsk C:1-247 [115984]
    Other proteins in same PDB: d1xska1, d1xska3, d1xska4, d1xskb1, d1xskb3, d1xskb4, d1xskc1, d1xskc3, d1xskc4, d1xskd1, d1xskd3, d1xskd4, d1xske1, d1xske3, d1xske4, d1xskf1, d1xskf3, d1xskf4

Details for d1xskc2

PDB Entry: 1xsk (more details), 2.2 Å

PDB Description: Structure of a Family 31 alpha glycosidase glycosyl-enzyme intermediate
PDB Compounds: (C:) Putative family 31 glucosidase yicI

SCOP Domain Sequences for d1xskc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xskc2 b.30.5.11 (C:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli [TaxId: 562]}
mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
vidgptp

SCOP Domain Coordinates for d1xskc2:

Click to download the PDB-style file with coordinates for d1xskc2.
(The format of our PDB-style files is described here.)

Timeline for d1xskc2: