![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily) sandwich; 10 strands in two sheets |
![]() | Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family) ![]() |
![]() | Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein) |
![]() | Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117128] (5 PDB entries) Uniprot P31434 |
![]() | Domain d1xskc1: 1xsk C:666-773 [115983] Other proteins in same PDB: d1xska2, d1xska3, d1xska4, d1xskb2, d1xskb3, d1xskb4, d1xskc2, d1xskc3, d1xskc4, d1xskd2, d1xskd3, d1xskd4, d1xske2, d1xske3, d1xske4, d1xskf2, d1xskf3, d1xskf4 complexed with mpo, so4, xyf |
PDB Entry: 1xsk (more details), 2.2 Å
SCOPe Domain Sequences for d1xskc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xskc1 b.150.1.1 (C:666-773) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]} ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh
Timeline for d1xskc1: