Class b: All beta proteins [48724] (178 folds) |
Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily) sandwich; 10 strands in two sheets |
Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) |
Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (3 proteins) |
Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species) |
Species Escherichia coli [TaxId:562] [117128] (5 PDB entries) Uniprot P31434 |
Domain d1xsjf1: 1xsj F:666-772 [115971] Other proteins in same PDB: d1xsja2, d1xsja3, d1xsja4, d1xsja5, d1xsjb2, d1xsjb3, d1xsjb4, d1xsjb5, d1xsjc2, d1xsjc3, d1xsjc4, d1xsjc5, d1xsjd2, d1xsjd3, d1xsjd4, d1xsjd5, d1xsje2, d1xsje3, d1xsje4, d1xsje5, d1xsjf2, d1xsjf3, d1xsjf4, d1xsjf5 complexed with trs |
PDB Entry: 1xsj (more details), 2.1 Å
SCOPe Domain Sequences for d1xsjf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsjf1 b.150.1.1 (F:666-772) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]} ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl
Timeline for d1xsjf1:
View in 3D Domains from same chain: (mouse over for more information) d1xsjf2, d1xsjf3, d1xsjf4, d1xsjf5 |