Lineage for d1xsje3 (1xsj E:586-665)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1328435Family b.71.1.4: Putative glucosidase YicI, domain 3 [117298] (1 protein)
  6. 1328436Protein Putative glucosidase YicI, domain 3 [117299] (1 species)
  7. 1328437Species Escherichia coli [TaxId:562] [117300] (5 PDB entries)
    Uniprot P31434
  8. 1328448Domain d1xsje3: 1xsj E:586-665 [115969]
    Other proteins in same PDB: d1xsja1, d1xsja2, d1xsja4, d1xsjb1, d1xsjb2, d1xsjb4, d1xsjc1, d1xsjc2, d1xsjc4, d1xsjd1, d1xsjd2, d1xsjd4, d1xsje1, d1xsje2, d1xsje4, d1xsjf1, d1xsjf2, d1xsjf4
    complexed with trs

Details for d1xsje3

PDB Entry: 1xsj (more details), 2.1 Å

PDB Description: Structure of a Family 31 alpha glycosidase
PDB Compounds: (E:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xsje3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsje3 b.71.1.4 (E:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]}
pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld
gsrwhkqqhgflslpvyvrd

SCOPe Domain Coordinates for d1xsje3:

Click to download the PDB-style file with coordinates for d1xsje3.
(The format of our PDB-style files is described here.)

Timeline for d1xsje3: