![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.11: Glycosyl hydrolase family 31, N-terminal domain-like [117139] (4 proteins) Pfam PF16863 |
![]() | Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117141] (5 PDB entries) Uniprot P31434 |
![]() | Domain d1xsje2: 1xsj E:1-247 [115968] Other proteins in same PDB: d1xsja1, d1xsja3, d1xsja4, d1xsja5, d1xsjb1, d1xsjb3, d1xsjb4, d1xsjb5, d1xsjc1, d1xsjc3, d1xsjc4, d1xsjc5, d1xsjd1, d1xsjd3, d1xsjd4, d1xsjd5, d1xsje1, d1xsje3, d1xsje4, d1xsje5, d1xsjf1, d1xsjf3, d1xsjf4, d1xsjf5 complexed with trs |
PDB Entry: 1xsj (more details), 2.1 Å
SCOPe Domain Sequences for d1xsje2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsje2 b.30.5.11 (E:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli [TaxId: 562]} mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf vidgptp
Timeline for d1xsje2:
![]() Domains from same chain: (mouse over for more information) d1xsje1, d1xsje3, d1xsje4, d1xsje5 |