Lineage for d1xsjd4 (1xsj D:248-585)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 571086Superfamily c.1.8: (Trans)glycosidases [51445] (13 families) (S)
  5. 572218Family c.1.8.13: YicI catalytic domain-like [117372] (1 protein)
  6. 572219Protein Putative glucosidase YicI, domain 2 [117373] (1 species)
  7. 572220Species Escherichia coli [TaxId:562] [117374] (3 PDB entries)
  8. 572236Domain d1xsjd4: 1xsj D:248-585 [115966]
    Other proteins in same PDB: d1xsja1, d1xsja2, d1xsja3, d1xsjb1, d1xsjb2, d1xsjb3, d1xsjc1, d1xsjc2, d1xsjc3, d1xsjd1, d1xsjd2, d1xsjd3, d1xsje1, d1xsje2, d1xsje3, d1xsjf1, d1xsjf2, d1xsjf3

Details for d1xsjd4

PDB Entry: 1xsj (more details), 2.1 Å

PDB Description: Structure of a Family 31 alpha glycosidase

SCOP Domain Sequences for d1xsjd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsjd4 c.1.8.13 (D:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli}
kavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlplhvfhfdc
fwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkelqekgyll
krpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfgeriptdvqw
fdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwggdcyany
esmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlhgsksyrv
pwayddescdvvrfftqlkcrmmpylyreaaranargt

SCOP Domain Coordinates for d1xsjd4:

Click to download the PDB-style file with coordinates for d1xsjd4.
(The format of our PDB-style files is described here.)

Timeline for d1xsjd4: