SCOP 1.73: Domain d1xsjb3: 1xsj B:586-665

Lineage for d1xsjb3 (1xsj B:586-665)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.4: Putative glucosidase YicI, domain 3 [117298] (1 protein)

6. Protein Putative glucosidase YicI, domain 3 [117299] (1 species)

7. Species Escherichia coli [TaxId:562] [117300] (5 PDB entries)

8. Domain d1xsjb3: 1xsj B:586-665 [115957]
   Other proteins in same PDB: d1xsja1, d1xsja2, d1xsja4, d1xsjb1, d1xsjb2, d1xsjb4, d1xsjc1, d1xsjc2, d1xsjc4, d1xsjd1, d1xsjd2, d1xsjd4, d1xsje1, d1xsje2, d1xsje4, d1xsjf1, d1xsjf2, d1xsjf4

Details for d1xsjb3

PDB Entry: 1xsj, 2.1 Å

PDB Description: Structure of a Family 31 alpha glycosidase

PDB Compounds: (B:) Putative family 31 glucosidase yicI

SCOP Domain Sequences for d1xsjb3:

Sequence; same for both SEQRES and ATOM records:

>d1xsjb3 b.71.1.4 (B:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]}
pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld
gsrwhkqqhgflslpvyvrd

Timeline for d1xsjb3:

• d1xsjb3 first appeared in SCOP 1.71
  
• d1xsjb3 appears in SCOP 1.75
  
• d1xsjb3 appears in the current release, SCOPe 2.08