Lineage for d1xsif2 (1xsi F:1-247)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 556788Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 556864Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 557152Family b.30.5.11: YicI N-terminal domain-like [117139] (1 protein)
  6. 557153Protein Putative glucosidase YicI, N-terminal domain [117140] (1 species)
  7. 557154Species Escherichia coli [TaxId:562] [117141] (3 PDB entries)
  8. 557160Domain d1xsif2: 1xsi F:1-247 [115948]
    Other proteins in same PDB: d1xsia1, d1xsia3, d1xsia4, d1xsib1, d1xsib3, d1xsib4, d1xsic1, d1xsic3, d1xsic4, d1xsid1, d1xsid3, d1xsid4, d1xsie1, d1xsie3, d1xsie4, d1xsif1, d1xsif3, d1xsif4
    complexed with acy, mpo, so4

Details for d1xsif2

PDB Entry: 1xsi (more details), 2.2 Å

PDB Description: Structure of a Family 31 alpha glycosidase

SCOP Domain Sequences for d1xsif2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsif2 b.30.5.11 (F:1-247) Putative glucosidase YicI, N-terminal domain {Escherichia coli}
mkisdgnwliqpglnlihplqvfeveqqdnemvvyaaprdvrertwqldtplftlrffsp
qegivgvriehfqgalnngphyplnilqdvkvtienteryaefksgnlsarvskgefwsl
dflrngeritgsqvknngyvqdtnnqrnymferldlgvgetvyglgerftalvrngqtve
twnrdggtsteqayknipfymtnrgygvlvnhpqcvsfevgsekvskvqfsveseyleyf
vidgptp

SCOP Domain Coordinates for d1xsif2:

Click to download the PDB-style file with coordinates for d1xsif2.
(The format of our PDB-style files is described here.)

Timeline for d1xsif2: