Lineage for d1xsie3 (1xsi E:586-665)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810903Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (4 proteins)
  6. 2810934Protein Putative glucosidase YicI, domain 3 [117299] (1 species)
  7. 2810935Species Escherichia coli [TaxId:562] [117300] (5 PDB entries)
    Uniprot P31434
  8. 2810952Domain d1xsie3: 1xsi E:586-665 [115945]
    Other proteins in same PDB: d1xsia1, d1xsia2, d1xsia4, d1xsia5, d1xsib1, d1xsib2, d1xsib4, d1xsib5, d1xsic1, d1xsic2, d1xsic4, d1xsic5, d1xsid1, d1xsid2, d1xsid4, d1xsid5, d1xsie1, d1xsie2, d1xsie4, d1xsie5, d1xsif1, d1xsif2, d1xsif4, d1xsif5
    complexed with acy, mpo, so4

Details for d1xsie3

PDB Entry: 1xsi (more details), 2.2 Å

PDB Description: Structure of a Family 31 alpha glycosidase
PDB Compounds: (E:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xsie3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsie3 b.71.1.4 (E:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]}
pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld
gsrwhkqqhgflslpvyvrd

SCOPe Domain Coordinates for d1xsie3:

Click to download the PDB-style file with coordinates for d1xsie3.
(The format of our PDB-style files is described here.)

Timeline for d1xsie3: