Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.4: Glycosyl hydrolase family 31, domain 3 [117298] (4 proteins) |
Protein Putative glucosidase YicI, domain 3 [117299] (1 species) |
Species Escherichia coli [TaxId:562] [117300] (5 PDB entries) Uniprot P31434 |
Domain d1xsie3: 1xsi E:586-665 [115945] Other proteins in same PDB: d1xsia1, d1xsia2, d1xsia4, d1xsia5, d1xsib1, d1xsib2, d1xsib4, d1xsib5, d1xsic1, d1xsic2, d1xsic4, d1xsic5, d1xsid1, d1xsid2, d1xsid4, d1xsid5, d1xsie1, d1xsie2, d1xsie4, d1xsie5, d1xsif1, d1xsif2, d1xsif4, d1xsif5 complexed with acy, mpo, so4 |
PDB Entry: 1xsi (more details), 2.2 Å
SCOPe Domain Sequences for d1xsie3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xsie3 b.71.1.4 (E:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli [TaxId: 562]} pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld gsrwhkqqhgflslpvyvrd
Timeline for d1xsie3:
View in 3D Domains from same chain: (mouse over for more information) d1xsie1, d1xsie2, d1xsie4, d1xsie5 |