SCOP 1.73: Domain d1xsie1: 1xsi E:666-773

Lineage for d1xsie1 (1xsi E:666-773)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily)
   sandwich; 10 strands in two sheets

4. Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family)

5. Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein)

6. Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)

7. Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)

8. Domain d1xsie1: 1xsi E:666-773 [115943]
   Other proteins in same PDB: d1xsia2, d1xsia3, d1xsia4, d1xsib2, d1xsib3, d1xsib4, d1xsic2, d1xsic3, d1xsic4, d1xsid2, d1xsid3, d1xsid4, d1xsie2, d1xsie3, d1xsie4, d1xsif2, d1xsif3, d1xsif4

Details for d1xsie1

PDB Entry: 1xsi, 2.2 Å

PDB Description: Structure of a Family 31 alpha glycosidase

PDB Compounds: (E:) Putative family 31 glucosidase yicI

SCOP Domain Sequences for d1xsie1:

Sequence; same for both SEQRES and ATOM records:

>d1xsie1 b.150.1.1 (E:666-773) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh

Timeline for d1xsie1:

• d1xsie1 first appeared in SCOP 1.71
  
• d1xsie1 appears in SCOP 1.75
  
• d1xsie1 appears in the current release, SCOPe 2.08