Lineage for d1xsib4 (1xsi B:248-585)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816800Family c.1.8.13: YicI catalytic domain-like [117372] (2 proteins)
  6. 816804Protein Putative glucosidase YicI, domain 2 [117373] (1 species)
  7. 816805Species Escherichia coli [TaxId:562] [117374] (5 PDB entries)
    Uniprot P31434
  8. 816819Domain d1xsib4: 1xsi B:248-585 [115934]
    Other proteins in same PDB: d1xsia1, d1xsia2, d1xsia3, d1xsib1, d1xsib2, d1xsib3, d1xsic1, d1xsic2, d1xsic3, d1xsid1, d1xsid2, d1xsid3, d1xsie1, d1xsie2, d1xsie3, d1xsif1, d1xsif2, d1xsif3

Details for d1xsib4

PDB Entry: 1xsi (more details), 2.2 Å

PDB Description: Structure of a Family 31 alpha glycosidase
PDB Compounds: (B:) Putative family 31 glucosidase yicI

SCOP Domain Sequences for d1xsib4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsib4 c.1.8.13 (B:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]}
kavldrytrftgrpalppawsfglwlttsfttnydeatvnsfidgmaernlplhvfhfdc
fwmkafqwcdfewdpltfpdpegmirrlkakglkicvwinpyigqkspvfkelqekgyll
krpdgslwqwdkwqpglaiydftnpdackwyadklkglvamgvdcfktdfgeriptdvqw
fdgsdpqkmhnhyayiynelvwnvlkdtvgeeeavlfarsasvgaqkfpvhwggdcyany
esmaeslrgglsiglsgfgfwshdiggfentapahvykrwcafgllsshsrlhgsksyrv
pwayddescdvvrfftqlkcrmmpylyreaaranargt

SCOP Domain Coordinates for d1xsib4:

Click to download the PDB-style file with coordinates for d1xsib4.
(The format of our PDB-style files is described here.)

Timeline for d1xsib4: