Lineage for d1xsib3 (1xsi B:586-665)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 566044Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 566045Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 566379Family b.71.1.4: Putative glucosidase YicI, domain 3 [117298] (1 protein)
  6. 566380Protein Putative glucosidase YicI, domain 3 [117299] (1 species)
  7. 566381Species Escherichia coli [TaxId:562] [117300] (3 PDB entries)
  8. 566383Domain d1xsib3: 1xsi B:586-665 [115933]
    Other proteins in same PDB: d1xsia1, d1xsia2, d1xsia4, d1xsib1, d1xsib2, d1xsib4, d1xsic1, d1xsic2, d1xsic4, d1xsid1, d1xsid2, d1xsid4, d1xsie1, d1xsie2, d1xsie4, d1xsif1, d1xsif2, d1xsif4

Details for d1xsib3

PDB Entry: 1xsi (more details), 2.2 Å

PDB Description: Structure of a Family 31 alpha glycosidase

SCOP Domain Sequences for d1xsib3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsib3 b.71.1.4 (B:586-665) Putative glucosidase YicI, domain 3 {Escherichia coli}
pmmrammmefpddpacdyldrqymlgdnvmvapvfteagdvqfylpegrwthlwhndeld
gsrwhkqqhgflslpvyvrd

SCOP Domain Coordinates for d1xsib3:

Click to download the PDB-style file with coordinates for d1xsib3.
(The format of our PDB-style files is described here.)

Timeline for d1xsib3: