Lineage for d1xsib1 (1xsi B:666-772)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825025Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 2825026Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) (S)
  5. 2825027Family b.150.1.1: Glycolsyl hydrolase family 31 C-terminal domain [117126] (4 proteins)
  6. 2825058Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)
  7. 2825059Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)
    Uniprot P31434
  8. 2825073Domain d1xsib1: 1xsi B:666-772 [115931]
    Other proteins in same PDB: d1xsia2, d1xsia3, d1xsia4, d1xsia5, d1xsib2, d1xsib3, d1xsib4, d1xsib5, d1xsic2, d1xsic3, d1xsic4, d1xsic5, d1xsid2, d1xsid3, d1xsid4, d1xsid5, d1xsie2, d1xsie3, d1xsie4, d1xsie5, d1xsif2, d1xsif3, d1xsif4, d1xsif5
    complexed with acy, mpo, so4

Details for d1xsib1

PDB Entry: 1xsi (more details), 2.2 Å

PDB Description: Structure of a Family 31 alpha glycosidase
PDB Compounds: (B:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xsib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsib1 b.150.1.1 (B:666-772) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitl

SCOPe Domain Coordinates for d1xsib1:

Click to download the PDB-style file with coordinates for d1xsib1.
(The format of our PDB-style files is described here.)

Timeline for d1xsib1: