SCOPe 2.05: Domain d1xsia1: 1xsi A:666-773

Lineage for d1xsia1 (1xsi A:666-773)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.150: Putative glucosidase YicI, C-terminal domain [117124] (1 superfamily)
   sandwich; 10 strands in two sheets

4. Superfamily b.150.1: Putative glucosidase YicI, C-terminal domain [117125] (1 family)

5. Family b.150.1.1: Putative glucosidase YicI, C-terminal domain [117126] (1 protein)

6. Protein Putative glucosidase YicI, C-terminal domain [117127] (1 species)

7. Species Escherichia coli [TaxId:562] [117128] (5 PDB entries)
   Uniprot P31434

8. Domain d1xsia1: 1xsi A:666-773 [115927]
   Other proteins in same PDB: d1xsia2, d1xsia3, d1xsia4, d1xsib2, d1xsib3, d1xsib4, d1xsic2, d1xsic3, d1xsic4, d1xsid2, d1xsid3, d1xsid4, d1xsie2, d1xsie3, d1xsie4, d1xsif2, d1xsif3, d1xsif4
   complexed with acy, mpo, so4

Details for d1xsia1

PDB Entry: 1xsi, 2.2 Å

PDB Description: Structure of a Family 31 alpha glycosidase

PDB Compounds: (A:) Putative family 31 glucosidase yicI

SCOPe Domain Sequences for d1xsia1:

Sequence; same for both SEQRES and ATOM records:

>d1xsia1 b.150.1.1 (A:666-773) Putative glucosidase YicI, C-terminal domain {Escherichia coli [TaxId: 562]}
ntllalgnndqrpdyvwhegtafhlfnlqdgheavcevpaadgsviftlkaartgntitv
tgageaknwtlclrnvvkvnglqdgsqaeseqglvvkpqgnaltitlh

Timeline for d1xsia1:

• d1xsia1 first appeared in SCOP 1.71
  
• d1xsia1 appears in SCOPe 2.04
  
• d1xsia1 appears in SCOPe 2.06
  
• d1xsia1 appears in the current release, SCOPe 2.08