Lineage for d1xseb_ (1xse B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 819766Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 819767Species Guinea pig (Cavia porcellus) [TaxId:10141] [117425] (1 PDB entry)
    Uniprot Q6QLL4 23-296
  8. 819769Domain d1xseb_: 1xse B: [115926]
    complexed with ndp

Details for d1xseb_

PDB Entry: 1xse (more details), 2.5 Å

PDB Description: crystal structure of guinea pig 11beta-hydroxysteroid dehydrogenase type 1
PDB Compounds: (B:) 11beta-hydroxysteroid dehydrogenase type 1

SCOP Domain Sequences for d1xseb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xseb_ c.2.1.2 (B:) 11-beta-hydroxysteroid dehydrogenase 1 {Guinea pig (Cavia porcellus) [TaxId: 10141]}
nekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelga
asahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevn
fhsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflv
nkvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrw
vpyllgnpgrkimeflsaaeynwdnvlsneklyg

SCOP Domain Coordinates for d1xseb_:

Click to download the PDB-style file with coordinates for d1xseb_.
(The format of our PDB-style files is described here.)

Timeline for d1xseb_: