Lineage for d1xsea_ (1xse A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841402Protein 11-beta-hydroxysteroid dehydrogenase 1 [117423] (3 species)
  7. 2841403Species Guinea pig (Cavia porcellus) [TaxId:10141] [117425] (4 PDB entries)
    Uniprot Q6QLL4 23-296
  8. 2841412Domain d1xsea_: 1xse A: [115925]
    complexed with ndp

Details for d1xsea_

PDB Entry: 1xse (more details), 2.5 Å

PDB Description: crystal structure of guinea pig 11beta-hydroxysteroid dehydrogenase type 1
PDB Compounds: (A:) 11beta-hydroxysteroid dehydrogenase type 1

SCOPe Domain Sequences for d1xsea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsea_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Guinea pig (Cavia porcellus) [TaxId: 10141]}
nekfrpemlqgkkvivtgaskgigreiayhlakmgahvvvtarskealqkvvarclelga
asahyiagsmedmtfaeefvaeagnlmggldmlilnhvlynrltffhgeidnvrksmevn
fhsfvvlsvaampmlmqsqgsiavvssvagkitypliapysaskfaldgffstlrseflv
nkvnvsitlcilglidtetaikatsgiylgpaspkeecaleiikgtalrqdemyyvgsrw
vpyllgnpgrkimeflsaaeynwdnvlsneklyg

SCOPe Domain Coordinates for d1xsea_:

Click to download the PDB-style file with coordinates for d1xsea_.
(The format of our PDB-style files is described here.)

Timeline for d1xsea_: