Lineage for d1xsaa_ (1xsa A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 871095Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 871096Superfamily d.113.1: Nudix [55811] (7 families) (S)
  5. 871097Family d.113.1.1: MutT-like [55812] (16 proteins)
  6. 871156Protein Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) [64367] (3 species)
  7. 871161Species Human (Homo sapiens) [TaxId:9606] [118084] (3 PDB entries)
    Uniprot P50583
  8. 871163Domain d1xsaa_: 1xsa A: [115922]
    mutant

Details for d1xsaa_

PDB Entry: 1xsa (more details)

PDB Description: structure of the nudix enzyme ap4a hydrolase from homo sapiens (e63a mutant)
PDB Compounds: (A:) Bis(5'-nucleosyl)-tetraphosphatase

SCOP Domain Sequences for d1xsaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsaa_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens) [TaxId: 9606]}
gplgsmalracgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddleta
lratqeeagieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayr
wlgleeacqlaqfkemkaalqeghqflcsieal

SCOP Domain Coordinates for d1xsaa_:

Click to download the PDB-style file with coordinates for d1xsaa_.
(The format of our PDB-style files is described here.)

Timeline for d1xsaa_: