Lineage for d1xsaa_ (1xsa A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609724Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 609725Superfamily d.113.1: Nudix [55811] (5 families) (S)
  5. 609726Family d.113.1.1: MutT-like [55812] (10 proteins)
  6. 609776Protein Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) [64367] (3 species)
  7. 609781Species Human (Homo sapiens) [TaxId:9606] [118084] (3 PDB entries)
  8. 609782Domain d1xsaa_: 1xsa A: [115922]
    mutant

Details for d1xsaa_

PDB Entry: 1xsa (more details)

PDB Description: Structure of the nudix enzyme AP4A hydrolase from homo sapiens (E63A mutant)

SCOP Domain Sequences for d1xsaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xsaa_ d.113.1.1 (A:) Diadenosine tetraphosphate hydrolase (Ap4A hydrolase) {Human (Homo sapiens)}
gplgsmalracgliifrrclipkvdnnaieflllqasdgihhwtppkghvepgeddleta
lratqeeagieagqltiiegfkrelnyvarnkpktviywlaevkdydveirlshehqayr
wlgleeacqlaqfkemkaalqeghqflcsieal

SCOP Domain Coordinates for d1xsaa_:

Click to download the PDB-style file with coordinates for d1xsaa_.
(The format of our PDB-style files is described here.)

Timeline for d1xsaa_: