![]() | Class i: Low resolution protein structures [58117] (24 folds) |
![]() | Fold i.11: Computational models partly based on NMR data [58198] (1 superfamily) |
![]() | Superfamily i.11.1: Computational models partly based on NMR data [58199] (1 family) ![]() |
![]() | Family i.11.1.1: Computational models partly based on NMR data [58200] (5 proteins) this is not a true family |
![]() | Protein Ternary complex formed between MarA, the alpha-CTD of RNA polymerase and DNA [118383] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [118384] (1 PDB entry) |
![]() | Domain d1xs9a_: 1xs9 A: [115921] |
PDB Entry: 1xs9 (more details)
SCOP Domain Sequences for d1xs9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xs9a_ i.11.1.1 (A:) Ternary complex formed between MarA, the alpha-CTD of RNA polymerase and DNA {Escherichia coli} mtmsrrntdaitihsildwiednlesplslekvsersgyskwhlqrmfkketghslgqyi rsrkmteiaqklkesnepilylaerygfesqqtltrtfknyfdvpphkyrmtnmqgesrf lhplnhyns
Timeline for d1xs9a_: