Lineage for d1xs9a_ (1xs9 A:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044923Fold i.11: Computational models partly based on experimental data [58198] (1 superfamily)
  4. 3044924Superfamily i.11.1: Computational models partly based on experimental data [58199] (1 family) (S)
  5. 3044925Family i.11.1.1: Computational models partly based on experimental data [58200] (6 proteins)
    this is not a true family
  6. 3044938Protein Ternary complex formed between MarA, the alpha-CTD of RNA polymerase and DNA [118383] (1 species)
  7. 3044939Species Escherichia coli [TaxId:562] [118384] (1 PDB entry)
  8. 3044940Domain d1xs9a_: 1xs9 A: [115921]
    protein/DNA complex; protein/RNA complex

Details for d1xs9a_

PDB Entry: 1xs9 (more details)

PDB Description: a model of the ternary complex formed between mara, the alpha-ctd of rna polymerase and dna
PDB Compounds: (A:) Multiple antibiotic resistance protein marA

SCOPe Domain Sequences for d1xs9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xs9a_ i.11.1.1 (A:) Ternary complex formed between MarA, the alpha-CTD of RNA polymerase and DNA {Escherichia coli [TaxId: 562]}
mtmsrrntdaitihsildwiednlesplslekvsersgyskwhlqrmfkketghslgqyi
rsrkmteiaqklkesnepilylaerygfesqqtltrtfknyfdvpphkyrmtnmqgesrf
lhplnhyns

SCOPe Domain Coordinates for d1xs9a_:

Click to download the PDB-style file with coordinates for d1xs9a_.
(The format of our PDB-style files is described here.)

Timeline for d1xs9a_: