Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.279: YggX-like [111147] (1 superfamily) beta(2)-alpha(3); contains zinc-less 'zinc finger'-like fold (57715) |
Superfamily d.279.1: YggX-like [111148] (2 families) automatically mapped to Pfam PF04362 |
Family d.279.1.1: YggX-like [111149] (2 proteins) Pfam PF04362 |
Protein Hypothetical protein YggX [118087] (2 species) |
Species Salmonella typhimurium [TaxId:90371] [118088] (1 PDB entry) Uniprot P67617 |
Domain d1xs8a_: 1xs8 A: [115920] structural genomics target |
PDB Entry: 1xs8 (more details)
SCOPe Domain Sequences for d1xs8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xs8a_ d.279.1.1 (A:) Hypothetical protein YggX {Salmonella typhimurium [TaxId: 90371]} msrtifctylqrdaegqdfqlypgelgkriyneiskdawaqwqhkqtmlinekklnmmna ehrklleqemvsflfegkdvhiegytpedkk
Timeline for d1xs8a_: