Lineage for d1xs8a_ (1xs8 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 617186Fold d.279: YggX-like [111147] (1 superfamily)
    beta(2)-alpha(3); contains zinc-less 'zinc finger'-like fold (scop_cf 57715; see also scop_cf 64375)
  4. 617187Superfamily d.279.1: YggX-like [111148] (1 family) (S)
  5. 617188Family d.279.1.1: YggX-like [111149] (2 proteins)
    Pfam 04362
  6. 617192Protein Hypothetical protein YggX [118087] (1 species)
  7. 617193Species Salmonella typhimurium [TaxId:90371] [118088] (1 PDB entry)
  8. 617194Domain d1xs8a_: 1xs8 A: [115920]
    structural genomics target

Details for d1xs8a_

PDB Entry: 1xs8 (more details)

PDB Description: solution structure of yggx protein of salmonella enterica

SCOP Domain Sequences for d1xs8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xs8a_ d.279.1.1 (A:) Hypothetical protein YggX {Salmonella typhimurium}
msrtifctylqrdaegqdfqlypgelgkriyneiskdawaqwqhkqtmlinekklnmmna
ehrklleqemvsflfegkdvhiegytpedkk

SCOP Domain Coordinates for d1xs8a_:

Click to download the PDB-style file with coordinates for d1xs8a_.
(The format of our PDB-style files is described here.)

Timeline for d1xs8a_: