Lineage for d1xs7d_ (1xs7 D:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 671907Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 671908Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 672460Family b.50.1.2: Pepsin-like [50646] (10 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 672515Protein beta-secretase (memapsin) [50671] (1 species)
  7. 672516Species Human (Homo sapiens) [TaxId:9606] [50672] (30 PDB entries)
  8. 672574Domain d1xs7d_: 1xs7 D: [115919]
    complexed with mmi

Details for d1xs7d_

PDB Entry: 1xs7 (more details), 2.8 Å

PDB Description: Crystal Structure of a cycloamide-urethane-derived novel inhibitor bound to human brain memapsin 2 (beta-secretase).
PDB Compounds: (D:) Beta-secretase 1

SCOP Domain Sequences for d1xs7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xs7d_ b.50.1.2 (D:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

SCOP Domain Coordinates for d1xs7d_:

Click to download the PDB-style file with coordinates for d1xs7d_.
(The format of our PDB-style files is described here.)

Timeline for d1xs7d_: