SCOPe 2.05: Domain d1xs6f_: 1xs6 F:

Lineage for d1xs6f_ (1xs6 F:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (2 families)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (5 proteins)

6. Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species)

7. Species Escherichia coli [TaxId:562] [117336] (6 PDB entries)
   Uniprot P28248

8. Domain d1xs6f_: 1xs6 F: [115918]
   complexed with dut, mg; mutant

Details for d1xs6f_

PDB Entry: 1xs6, 2 Å

PDB Description: dctp deaminase from escherichia coli. e138a mutant enzyme in complex with dutp

PDB Compounds: (F:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d1xs6f_:

Sequence; same for both SEQRES and ATOM records:

>d1xs6f_ b.85.4.1 (F:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]}
mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
nqqgavasridkd

Timeline for d1xs6f_:

• d1xs6f_ first appeared in SCOP 1.71
  
• d1xs6f_ appears in SCOPe 2.04
  
• d1xs6f_ appears in SCOPe 2.06
  
• d1xs6f_ appears in the current release, SCOPe 2.08