Lineage for d1xs6c_ (1xs6 C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 568126Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 568241Superfamily b.85.4: dUTPase-like [51283] (1 family) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 568242Family b.85.4.1: dUTPase-like [51284] (3 proteins)
  6. 568253Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (1 species)
  7. 568254Species Escherichia coli [TaxId:562] [117336] (3 PDB entries)
  8. 568263Domain d1xs6c_: 1xs6 C: [115915]

Details for d1xs6c_

PDB Entry: 1xs6 (more details), 2 Å

PDB Description: dctp deaminase from escherichia coli. e138a mutant enzyme in complex with dutp

SCOP Domain Sequences for d1xs6c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xs6c_ b.85.4.1 (C:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli}
mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
nqqgavasridkd

SCOP Domain Coordinates for d1xs6c_:

Click to download the PDB-style file with coordinates for d1xs6c_.
(The format of our PDB-style files is described here.)

Timeline for d1xs6c_: