SCOP 1.75: Domain d1xs5a_: 1xs5 A:

Lineage for d1xs5a_ (1xs5 A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Putative lipoprotein (NlpA family) [102700] (2 species)
   aka PG110, TpN32

7. Species Treponema pallidum [TaxId:160] [117746] (1 PDB entry)
   Uniprot O07950 28-267

8. Domain d1xs5a_: 1xs5 A: [115912]
   Structural genomics target
   complexed with met

Details for d1xs5a_

PDB Entry: 1xs5, 1.85 Å

PDB Description: The Crystal Structure of Lipoprotein Tp32 from Treponema pallidum

PDB Compounds: (A:) Membrane lipoprotein TpN32

SCOP Domain Sequences for d1xs5a_:

Sequence; same for both SEQRES and ATOM records:

>d1xs5a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Treponema pallidum [TaxId: 160]}
kdetvgvgvlsepharlleiakeevkkqhielriveftnyvalneavmrgdilmnffqhv
phmqqfnqehngdlvsvgnvhveplalysrtyrhvsdfpagaviaipndssnearalrll
eaagfirmragsglfatvedvqqnvrnvvlqevesallprvfdqvdgavingnyaimagl
sarrdglavepdasayanvlvvkrgneadarvqavlralcggrvrtylkerykggevapa

Timeline for d1xs5a_:

• d1xs5a_ first appeared in SCOP 1.71
  
• d1xs5a_ appears in SCOP 1.73
  
• d1xs5a_ appears in SCOPe 2.01
  
• d1xs5a_ appears in the current release, SCOPe 2.08