Lineage for d1xs4c_ (1xs4 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818071Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 2818072Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 2818085Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (2 species)
  7. 2818086Species Escherichia coli [TaxId:562] [117336] (6 PDB entries)
    Uniprot P28248
  8. 2818113Domain d1xs4c_: 1xs4 C: [115908]
    complexed with dcp, mg; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1xs4c_

PDB Entry: 1xs4 (more details), 2.53 Å

PDB Description: dctp deaminase from escherichia coli- e138a mutant enzyme in complex with dctp
PDB Compounds: (C:) deoxycytidine triphosphate deaminase

SCOPe Domain Sequences for d1xs4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xs4c_ b.85.4.1 (C:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]}
mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
hvtahridpgwsgcivlafynsgklplalrpgmligalsfeplsgpavrpynrredakyr
nqqgavasridkd

SCOPe Domain Coordinates for d1xs4c_:

Click to download the PDB-style file with coordinates for d1xs4c_.
(The format of our PDB-style files is described here.)

Timeline for d1xs4c_: