Lineage for d1xs2c2 (1xs2 C:6-132)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1904959Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1904960Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1904961Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1905160Protein N-acylamino acid racemase [110937] (4 species)
  7. 1905178Species Deinococcus radiodurans [TaxId:1299] [110939] (4 PDB entries)
    Uniprot Q9RYA6
  8. 1905193Domain d1xs2c2: 1xs2 C:6-132 [115903]
    Other proteins in same PDB: d1xs2a1, d1xs2b1, d1xs2c1, d1xs2d1
    complexed with mg

Details for d1xs2c2

PDB Entry: 1xs2 (more details), 2.3 Å

PDB Description: Structural Basis for Catalytic Racemization and Substrate Specificity of an N-Acylamino Acid Racemase Homologue from Deinococcus radiodurans
PDB Compounds: (C:) N-acylamino acid racemase

SCOPe Domain Sequences for d1xs2c2:

Sequence, based on SEQRES records: (download)

>d1xs2c2 d.54.1.1 (C:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
rmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearpmyree
tiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvp
lgtllgg

Sequence, based on observed residues (ATOM records): (download)

>d1xs2c2 d.54.1.1 (C:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgg

SCOPe Domain Coordinates for d1xs2c2:

Click to download the PDB-style file with coordinates for d1xs2c2.
(The format of our PDB-style files is described here.)

Timeline for d1xs2c2: