Lineage for d1xs1e_ (1xs1 E:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 811032Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 811150Superfamily b.85.4: dUTPase-like [51283] (1 family) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 811151Family b.85.4.1: dUTPase-like [51284] (4 proteins)
  6. 811163Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (1 species)
  7. 811164Species Escherichia coli [TaxId:562] [117336] (3 PDB entries)
    Uniprot P28248
  8. 811169Domain d1xs1e_: 1xs1 E: [115896]

Details for d1xs1e_

PDB Entry: 1xs1 (more details), 1.8 Å

PDB Description: dctp deaminase from escherichia coli in complex with dutp
PDB Compounds: (E:) deoxycytidine triphosphate deaminase

SCOP Domain Sequences for d1xs1e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xs1e_ b.85.4.1 (E:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli [TaxId: 562]}
mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
hvtahridpgwsgcivlefynsgklplalrpgmligalsfeplsgpavrpynrredakyr
nqqgavasridkd

SCOP Domain Coordinates for d1xs1e_:

Click to download the PDB-style file with coordinates for d1xs1e_.
(The format of our PDB-style files is described here.)

Timeline for d1xs1e_: