![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.4: dUTPase-like [51283] (1 family) ![]() forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
![]() | Family b.85.4.1: dUTPase-like [51284] (3 proteins) |
![]() | Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [117336] (3 PDB entries) |
![]() | Domain d1xs1b_: 1xs1 B: [115893] |
PDB Entry: 1xs1 (more details), 1.8 Å
SCOP Domain Sequences for d1xs1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xs1b_ b.85.4.1 (B:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli} mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv hvtahridpgwsgcivlefynsgklplalrpgmligalsfeplsgpavrpynrredakyr nqqgavasridkd
Timeline for d1xs1b_: