SCOP 1.71: Domain d1xs1b_: 1xs1 B:

Lineage for d1xs1b_ (1xs1 B:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.4: dUTPase-like [51283] (1 family)
   forms tight trimer through an additional beta-sheet in each subunit
   subunit beta-sheets are orthogonally packed around the three-fold axis

5. Family b.85.4.1: dUTPase-like [51284] (3 proteins)

6. Protein Deoxycytidine triphosphate deaminase (dCTP deaminase) [117335] (1 species)

7. Species Escherichia coli [TaxId:562] [117336] (3 PDB entries)

8. Domain d1xs1b_: 1xs1 B: [115893]

Details for d1xs1b_

PDB Entry: 1xs1, 1.8 Å

PDB Description: dctp deaminase from escherichia coli in complex with dutp

SCOP Domain Sequences for d1xs1b_:

Sequence; same for both SEQRES and ATOM records:

>d1xs1b_ b.85.4.1 (B:) Deoxycytidine triphosphate deaminase (dCTP deaminase) {Escherichia coli}
mrlcdrdieawldegrlsinprppveringatvdvrlgnkfrtfrghtaafidlsgpkde
vsaaldrvmsdeivldegeafylhpgelalavtlesvtlpadlvgwldgrsslarlglmv
hvtahridpgwsgcivlefynsgklplalrpgmligalsfeplsgpavrpynrredakyr
nqqgavasridkd

Timeline for d1xs1b_:

• d1xs1b_ is new in SCOP 1.71
  
• d1xs1b_ appears in SCOP 1.73
  
• d1xs1b_ appears in the current release, SCOPe 2.08