Lineage for d1xs0c1 (1xs0 C:3-128)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2240542Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
    alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet
  4. 2240543Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) (S)
    automatically mapped to Pfam PF08816
  5. 2240544Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (2 proteins)
  6. 2240545Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
    formerly hypothetical protein YkfE
  7. 2240546Species Escherichia coli [TaxId:562] [89875] (2 PDB entries)
    Uniprot P45502 31-157
  8. 2240551Domain d1xs0c1: 1xs0 C:3-128 [115891]
    Other proteins in same PDB: d1xs0a2, d1xs0b2, d1xs0c2

Details for d1xs0c1

PDB Entry: 1xs0 (more details), 1.58 Å

PDB Description: Structure of the E. coli Ivy protein
PDB Compounds: (C:) inhibitor of vertebrate lysozyme

SCOPe Domain Sequences for d1xs0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xs0c1 d.233.1.1 (C:3-128) Inhibitor of vertebrate lysozyme, Ivy {Escherichia coli [TaxId: 562]}
dltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackphdc
gsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgslenh
pdgfnf

SCOPe Domain Coordinates for d1xs0c1:

Click to download the PDB-style file with coordinates for d1xs0c1.
(The format of our PDB-style files is described here.)

Timeline for d1xs0c1: