![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily) alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet |
![]() | Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) ![]() automatically mapped to Pfam PF08816 |
![]() | Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (2 proteins) |
![]() | Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species) formerly hypothetical protein YkfE |
![]() | Species Escherichia coli [TaxId:562] [89875] (2 PDB entries) Uniprot P45502 31-157 |
![]() | Domain d1xs0b1: 1xs0 B:1-128 [115890] Other proteins in same PDB: d1xs0a2, d1xs0b2, d1xs0c2 |
PDB Entry: 1xs0 (more details), 1.58 Å
SCOPe Domain Sequences for d1xs0b1:
Sequence, based on SEQRES records: (download)
>d1xs0b1 d.233.1.1 (B:1-128) Inhibitor of vertebrate lysozyme, Ivy {Escherichia coli [TaxId: 562]} qddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackph dcgsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgsle nhpdgfnf
>d1xs0b1 d.233.1.1 (B:1-128) Inhibitor of vertebrate lysozyme, Ivy {Escherichia coli [TaxId: 562]} qddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackph dcgsqriavmwseksnqmtglfstidekqekltwlnvndalsidgktvlfaaltgslenh pdgfnf
Timeline for d1xs0b1:
![]() Domains from other chains: (mouse over for more information) d1xs0a1, d1xs0a2, d1xs0c1, d1xs0c2 |