Lineage for d1xs0b_ (1xs0 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1051863Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
    alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet
  4. 1051864Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) (S)
  5. 1051865Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (1 protein)
  6. 1051866Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
    formerly hypothetical protein YkfE
  7. 1051867Species Escherichia coli [TaxId:562] [89875] (2 PDB entries)
    Uniprot P45502 31-157
  8. 1051871Domain d1xs0b_: 1xs0 B: [115890]

Details for d1xs0b_

PDB Entry: 1xs0 (more details), 1.58 Å

PDB Description: Structure of the E. coli Ivy protein
PDB Compounds: (B:) inhibitor of vertebrate lysozyme

SCOPe Domain Sequences for d1xs0b_:

Sequence, based on SEQRES records: (download)

>d1xs0b_ d.233.1.1 (B:) Inhibitor of vertebrate lysozyme, Ivy {Escherichia coli [TaxId: 562]}
qddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackph
dcgsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgsle
nhpdgfnfr

Sequence, based on observed residues (ATOM records): (download)

>d1xs0b_ d.233.1.1 (B:) Inhibitor of vertebrate lysozyme, Ivy {Escherichia coli [TaxId: 562]}
qddltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackph
dcgsqriavmwseksnqmtglfstidekqekltwlnvndalsidgktvlfaaltgslenh
pdgfnfr

SCOPe Domain Coordinates for d1xs0b_:

Click to download the PDB-style file with coordinates for d1xs0b_.
(The format of our PDB-style files is described here.)

Timeline for d1xs0b_: