Lineage for d1xs0a_ (1xs0 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740642Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
    alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet
  4. 740643Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) (S)
  5. 740644Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (1 protein)
  6. 740645Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
    formerly hypothetical protein YkfE
  7. 740646Species Escherichia coli [TaxId:562] [89875] (2 PDB entries)
  8. 740649Domain d1xs0a_: 1xs0 A: [115889]

Details for d1xs0a_

PDB Entry: 1xs0 (more details), 1.58 Å

PDB Description: Structure of the E. coli Ivy protein
PDB Compounds: (A:) inhibitor of vertebrate lysozyme

SCOP Domain Sequences for d1xs0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xs0a_ d.233.1.1 (A:) Inhibitor of vertebrate lysozyme, Ivy {Escherichia coli [TaxId: 562]}
dltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackphdc
gsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgslenh
pdgfnfrs

SCOP Domain Coordinates for d1xs0a_:

Click to download the PDB-style file with coordinates for d1xs0a_.
(The format of our PDB-style files is described here.)

Timeline for d1xs0a_: