SCOPe 2.08: Domain d1xs0a1: 1xs0 A:3-128

Lineage for d1xs0a1 (1xs0 A:3-128)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
   alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet

4. Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family)
   automatically mapped to Pfam PF08816

5. Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (2 proteins)

6. Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
   formerly hypothetical protein YkfE

7. Species Escherichia coli [TaxId:562] [89875] (2 PDB entries)
   Uniprot P45502 31-157

8. Domain d1xs0a1: 1xs0 A:3-128 [115889]
   Other proteins in same PDB: d1xs0a2, d1xs0b2, d1xs0c2

Details for d1xs0a1

PDB Entry: 1xs0, 1.58 Å

PDB Description: Structure of the E. coli Ivy protein

PDB Compounds: (A:) inhibitor of vertebrate lysozyme

SCOPe Domain Sequences for d1xs0a1:

Sequence; same for both SEQRES and ATOM records:

>d1xs0a1 d.233.1.1 (A:3-128) Inhibitor of vertebrate lysozyme, Ivy {Escherichia coli [TaxId: 562]}
dltisslakgettkaafnqmvqghklpawvmkggtytpaqtvtlgdetyqvmsackphdc
gsqriavmwseksnqmtglfstidektsqekltwlnvndalsidgktvlfaaltgslenh
pdgfnf

Timeline for d1xs0a1:

• d1xs0a1 first appeared in SCOP 1.71, called d1xs0a_
  
• d1xs0a1 appears in SCOPe 2.07