SCOP 1.75: Domain d1xrva2: 1xrv A:240-307

Lineage for d1xrva2 (1xrv A:240-307)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Pig (Sus scrofa) [TaxId:9823] [117869] (4 PDB entries)
   Uniprot Q5UC99

8. Domain d1xrva2: 1xrv A:240-307 [115887]
   Other proteins in same PDB: d1xrva1
   complexed with nag

Details for d1xrva2

PDB Entry: 1xrv, 2.1 Å

PDB Description: crystal structure of the novel secretory signalling protein from porcine (spp-40) at 2.1a resolution.

PDB Compounds: (A:) signal processing protein

SCOP Domain Sequences for d1xrva2:

Sequence; same for both SEQRES and ATOM records:

>d1xrva2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa) [TaxId: 9823]}
fgksftlassktdvgapvsgpgipgqftkekgilayyeicdflqgatthrfrdqqvpyat
kgnqwvay

Timeline for d1xrva2:

• d1xrva2 first appeared in SCOP 1.71
  
• d1xrva2 appears in SCOP 1.73
  
• d1xrva2 appears in SCOPe 2.01
  
• d1xrva2 appears in the current release, SCOPe 2.08