Lineage for d1xrva1 (1xrv A:1-239,A:308-361)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083165Family c.1.8.5: Type II chitinase [51534] (15 protein domains)
    glycosylase family 18
  6. 2083343Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
    secreted during involution
  7. 2083371Species Pig (Sus scrofa) [TaxId:9823] [117369] (4 PDB entries)
    Uniprot Q5UC99
  8. 2083372Domain d1xrva1: 1xrv A:1-239,A:308-361 [115886]
    Other proteins in same PDB: d1xrva2

Details for d1xrva1

PDB Entry: 1xrv (more details), 2.1 Å

PDB Description: Crystal Structure of the novel secretory signalling protein from Porcine (SPP-40) at 2.1A resolution.
PDB Compounds: (A:) signal processing protein

SCOPe Domain Sequences for d1xrva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrva1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa) [TaxId: 9823]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpnlktllsvggwnfgpqrfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgqedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlar

SCOPe Domain Coordinates for d1xrva1:

Click to download the PDB-style file with coordinates for d1xrva1.
(The format of our PDB-style files is described here.)

Timeline for d1xrva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xrva2