Lineage for d1xrva1 (1xrv A:1-239,A:308-361)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.5: Type II chitinase [51534] (15 proteins)
glycosylase family 18
Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
secreted during involution
Species Pig (Sus scrofa) [TaxId:9823] [117369] (4 PDB entries)
Uniprot Q5UC99
Domain d1xrva1: 1xrv A:1-239,A:308-361 [115886]
Other proteins in same PDB: d1xrva2
Details for d1xrva1
PDB Entry: 1xrv (more details), 2.1 Å
PDB Description: crystal structure of the novel secretory signalling protein from porcine (spp-40) at 2.1a resolution.
PDB Compounds: (A:) signal processing proteinSCOPe Domain Sequences for d1xrva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xrva1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Pig (Sus scrofa) [TaxId: 9823]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpnlktllsvggwnfgpqrfskiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfrgqedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlar
SCOPe Domain Coordinates for d1xrva1:
Click to download the PDB-style file with coordinates for d1xrva1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1xrva1:
- d1xrva1 first appeared in SCOP 1.71
- d1xrva1 appears in SCOPe 2.07
View in 3D
