Lineage for d1xrsb2 (1xrs B:33-84)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881009Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 881117Superfamily d.230.4: D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain [117778] (1 family) (S)
  5. 881118Family d.230.4.1: D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain [117779] (1 protein)
  6. 881119Protein D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain [117780] (1 species)
    homo-dimerisation domain
  7. 881120Species Clostridium sticklandii [TaxId:1511] [117781] (1 PDB entry)
    Uniprot Q9ZFE5
  8. 881121Domain d1xrsb2: 1xrs B:33-84 [115885]
    Other proteins in same PDB: d1xrsa_, d1xrsb1
    complexed with 5ad, b12, plp

Details for d1xrsb2

PDB Entry: 1xrs (more details), 2.8 Å

PDB Description: crystal structure of lysine 5,6-aminomutase in complex with plp, cobalamin, and 5'-deoxyadenosine
PDB Compounds: (B:) D-lysine 5,6-aminomutase beta subunit

SCOP Domain Sequences for d1xrsb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xrsb2 d.230.4.1 (B:33-84) D-lysine 5,6-aminomutase beta subunit KamE, N-terminal domain {Clostridium sticklandii [TaxId: 1511]}
kvqlsftlplknnersaeaakqialkmgleepsvvmqqsldeeftffvvygn

SCOP Domain Coordinates for d1xrsb2:

Click to download the PDB-style file with coordinates for d1xrsb2.
(The format of our PDB-style files is described here.)

Timeline for d1xrsb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xrsb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1xrsa_